PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00007.1.g09430.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 376aa    MW: 38248.5 Da    PI: 8.8333
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00007.1.g09430.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.3e-3978139263
                          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                                     kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Zjn_sc00007.1.g09430.1.sm.mkhc  78 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 139
                                     7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3176136IPR003851Zinc finger, Dof-type
PfamPF027012.5E-3380136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05982136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MDAAHWHQGL GLVKPMEEML MAGNPNPNQN QNPAPAAPSA PPGGAQRAGV PAGSAAAPAA  60
GAGTDAGAGT ERRARPQKEK ALNCPRCNST NTKFCYYNNY SLQQPRYFCK TCRRYWTEGG  120
SLRNVPVGGG SRKNKRSSSS VSVAAATTSA AMSGTVPVGV GLAAAKNPKL VHEGAQDLNL  180
AFPHHNGRGL QPPEFAAFPS LESSSVCNPA GAAMAGTGAG GRGVGAFSAM ELLRSTGYYV  240
PLQHMQLGMP AEYTSAGFAL GELRMPPPPQ SQSVLGFSLD THGTGGVGGP GAYSAALQDS  300
AAGRLLFPFE DLKPAVCAAG GGVSNTVGDH QYEHSKDQGG DGRAASGVTG GHQTPGFWNN  360
SMIGNASSNG SGGGPW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953427.11e-155PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLC5Y1A11e-149C5Y1A1_SORBI; Dof-type zinc finger protein 16
STRINGSb04g032040.11e-148(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.14e-43Dof family protein